DB00001BTD00024BIOD00024LepirudinLepirudin is identical to natural hirudin except for substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. It is produced via yeast cells. Bayer ceased the production of lepirudin (Refludan) effective May 31, 2012.138068-37-8Y43GF64R34liquidapprovedA116244762Smythe MA, Stephens JL, Koerber JM, Mattson JC: A comparison of lepirudin and argatroban outcomes. Clin Appl Thromb Hemost. 2005 Oct;11(4):371-4.A216690967Tardy B, Lecompte T, Boelhen F, Tardy-Poncet B, Elalamy I, Morange P, Gruel Y, Wolf M, Francois D, Racadot E, Camarasa P, Blouch MT, Nguyen F, Doubine S, Dutrillaux F, Alhenc-Gelas M, Martin-Toutain I, Bauters A, Ffrench P, de Maistre E, Grunebaum L, Mouton C, Huisse MG, Gouault-Heilmann M, Lucke V: Predictive factors for thrombosis and major bleeding in an observational study in 181 patients with heparin-induced thrombocytopenia treated with lepirudin. Blood. 2006 Sep 1;108(5):1492-6. Epub 2006 May 11.A316241940Lubenow N, Eichler P, Lietz T, Greinacher A: Lepirudin in patients with heparin-induced thrombocytopenia - results of the third prospective study (HAT-3) and a combined analysis of HAT-1, HAT-2, and HAT-3. J Thromb Haemost. 2005 Nov;3(11):2428-36.L48Google bookshttp://books.google.com/books?id=iadLoXoQkWEC&pg=PA440For the treatment of heparin-induced thrombocytopeniaLepirudin is used to break up clots and to reduce thrombocytopenia. It binds to thrombin and prevents thrombus or clot formation. It is a highly potent, selective, and essentially irreversible inhibitor of thrombin and clot-bond thrombin. Lepirudin requires no cofactor for its anticoagulant action. Lepirudin is a recombinant form of hirudin, an endogenous anticoagulant found in medicinal leeches.Lepirudin forms a stable non-covalent complex with alpha-thrombin, thereby abolishing its ability to cleave fibrinogen and initiate the clotting cascade. The inhibition of thrombin prevents the blood clotting cascade. In case of overdose (eg, suggested by excessively high aPTT values) the risk of bleeding is increased.Lepirudin is thought to be metabolized by release of amino acids via catabolic hydrolysis of the parent drug. However, con-clusive data are not available. About 48% of the administration dose is excreted in the urine which consists of unchanged drug (35%) and other fragments of the parent drug.Bioavailability is 100% following injection.Approximately 1.3 hoursLepirudin is thought to be metabolized by release of amino acids via catabolic hydrolysis of the parent drug. About 48% of the administration dose is excreted in the urine which consists of unchanged drug (35%) and other fragments of the parent drug.* 12.2 L [Healthy young subjects (n = 18, age 18-60 years)]
* 18.7 L [Healthy elderly subjects (n = 10, age 65-80 years)]
* 18 L [Renally impaired patients (n = 16, creatinine clearance below 80 mL/min)]
* 32.1 L [HIT patients (n = 73)]* 164 ml/min [Healthy 18-60 yrs]
* 139 ml/min [Healthy 65-80 yrs]
* 61 ml/min [renal impaired]
* 114 ml/min [HIT (Heparin-induced thrombocytopenia)]PeptidesOrganic CompoundsOrganic AcidsCarboxylic Acids and DerivativesAmino Acids, Peptides, and AnaloguesHirudin variant-1LepirudinLepirudin recombinantRefludanBayer50419-1501998-03-062013-06-30Powder50 mg/1mLIntravenousNDA020807falsefalsetrueUSFDA NDCRefludanBayer022409962000-01-312013-07-26Powder, for solution50 mg / vialIntravenousfalsefalsetrueCanadaDPDRefludanCelgene Europe LimitedEMEA/H/C/000122EU/1/97/035/0012016-09-082012-07-27Injection, solution, concentrate50 mgIntravenousfalsefalsefalseEUEMARefludanCelgene Europe LimitedEMEA/H/C/000122EU/1/97/035/0022016-09-082012-07-27Injection, solution, concentrate50 mgIntravenousfalsefalsefalseEUEMARefludanCelgene Europe LimitedEMEA/H/C/000122EU/1/97/035/0032016-09-082012-07-27Injection, solution, concentrate20 mgIntravenousfalsefalsefalseEUEMARefludanCelgene Europe LimitedEMEA/H/C/000122EU/1/97/035/0042016-09-082012-07-27Injection, solution, concentrate20 mgIntravenousfalsefalsefalseEUEMARefludanLepirudinRefludanLepirudinRefludanLepirudinRefludanLepirudinRefludanLepirudinRefludanLepirudinBayer Healthcarehttp://www.bayerhealthcare.comBerlex Labshttp://www.berlex.comBayer healthcare pharmaceuticals incRefludan 50 mg vial273.19vialAmino Acids, Peptides, and ProteinsD000602AnticoagulantsD000925Antithrombin ProteinsD058833AntithrombinsD000991Blood and Blood Forming OrgansCardiovascular AgentsD002317Enzyme InhibitorsD004791Fibrin Modulating AgentsD050299Hematologic AgentsD006401PeptidesD010455Protease InhibitorsD011480ProteinsD011506Serine Protease InhibitorsD015842SerpinsD015843Thrombin InhibitorsHumans and other mammalsIntravenous50 mgIntravenous20 mgIntravenous50 mgIntravenousIntravenous50 mg/1mLIntravenous50 mg / vialDirect thrombin inhibitorsANTITHROMBOTIC AGENTSANTITHROMBOTIC AGENTSBLOOD AND BLOOD FORMING ORGANS//s3-us-west-2.amazonaws.com/drugbank/fda_labels/DB00001.pdf?1265924858//s3-us-west-2.amazonaws.com/drugbank/msds/DB00001.pdf?13684162455180668United States1993-01-192010-01-19falseAvoid herbs and supplements with anticoagulant/antiplatelet activity. Examples include garlic, ginger, bilberry, danshen, piracetam, and ginkgo biloba.DB06605ApixabanApixaban may increase the anticoagulant activities of Lepirudin.DB06695Dabigatran etexilateDabigatran etexilate may increase the anticoagulant activities of Lepirudin.DB01254DasatinibThe risk or severity of bleeding and hemorrhage can be increased when Dasatinib is combined with Lepirudin.DB01609DeferasiroxThe risk or severity of gastrointestinal bleeding can be increased when Lepirudin is combined with Deferasirox.DB01586Ursodeoxycholic acidThe risk or severity of bleeding and bruising can be increased when Lepirudin is combined with Ursodeoxycholic acid.DB02123Glycochenodeoxycholic AcidThe risk or severity of bleeding and bruising can be increased when Lepirudin is combined with Glycochenodeoxycholic Acid.DB02659Cholic AcidThe risk or severity of bleeding and bruising can be increased when Lepirudin is combined with Cholic Acid.DB02691Glycocholic acidThe risk or severity of bleeding and bruising can be increased when Lepirudin is combined with Glycocholic acid.DB03619Deoxycholic acidThe risk or severity of bleeding and bruising can be increased when Lepirudin is combined with Deoxycholic acid.DB04348Taurocholic acidThe risk or severity of bleeding and bruising can be increased when Lepirudin is combined with Taurocholic acid.DB05990Obeticholic acidThe risk or severity of bleeding and bruising can be increased when Lepirudin is combined with Obeticholic acid.DB06777Chenodeoxycholic acidThe risk or severity of bleeding and bruising can be increased when Lepirudin is combined with Chenodeoxycholic acid.DB08833Taurochenodeoxycholic acidThe risk or severity of bleeding and bruising can be increased when Lepirudin is combined with Taurochenodeoxycholic acid.DB08834Tauroursodeoxycholic acidThe risk or severity of bleeding and bruising can be increased when Lepirudin is combined with Tauroursodeoxycholic acid.DB08857Bamet-UD2The risk or severity of bleeding and bruising can be increased when Lepirudin is combined with Bamet-UD2.DB11622Dehydrocholic acidThe risk or severity of bleeding and bruising can be increased when Lepirudin is combined with Dehydrocholic acid.DB11789Hyodeoxycholic AcidThe risk or severity of bleeding and bruising can be increased when Lepirudin is combined with Hyodeoxycholic Acid.DB09075EdoxabanThe risk or severity of bleeding can be increased when Edoxaban is combined with Lepirudin.DB09053IbrutinibThe risk or severity of bleeding and hemorrhage can be increased when Ibrutinib is combined with Lepirudin.DB08935ObinutuzumabThe risk or severity of bleeding and hemorrhage can be increased when Lepirudin is combined with Obinutuzumab.DB06228RivaroxabanLepirudin may increase the anticoagulant activities of Rivaroxaban.DB06206SugammadexThe risk or severity of bleeding and hemorrhage can be increased when Lepirudin is combined with Sugammadex.DB09070TiboloneTibolone may increase the anticoagulant activities of Lepirudin.DB00932TipranavirThe risk or severity of bleeding and hemorrhage can be increased when Tipranavir is combined with Lepirudin.DB00013UrokinaseUrokinase may increase the anticoagulant activities of Lepirudin.DB00163Vitamin EVitamin E may increase the anticoagulant activities of Lepirudin.DB09030VorapaxarThe risk or severity of bleeding and hemorrhage can be increased when Vorapaxar is combined with Lepirudin.DB01381Ginkgo bilobaGinkgo biloba may increase the anticoagulant activities of Lepirudin.DB01181IfosfamideThe risk or severity of bleeding can be increased when Ifosfamide is combined with Lepirudin.DB00468QuinineThe therapeutic efficacy of Lepirudin can be increased when used in combination with Quinine.DB00908QuinidineThe therapeutic efficacy of Lepirudin can be increased when used in combination with Quinidine.DB00675TamoxifenThe risk or severity of bleeding can be increased when Tamoxifen is combined with Lepirudin.DB00539ToremifeneThe risk or severity of bleeding can be increased when Toremifene is combined with Lepirudin.DB00806PentoxifyllineThe therapeutic efficacy of Lepirudin can be increased when used in combination with Pentoxifylline.DB00686Pentosan polysulfatePentosan polysulfate may increase the anticoagulant activities of Lepirudin.DB00583LevocarnitineThe therapeutic efficacy of Lepirudin can be increased when used in combination with Levocarnitine.DB00255DiethylstilbestrolDiethylstilbestrol may decrease the anticoagulant activities of Lepirudin.DB00269ChlorotrianiseneChlorotrianisene may decrease the anticoagulant activities of Lepirudin.DB00286Conjugated estrogensConjugated estrogens may decrease the anticoagulant activities of Lepirudin.DB01357MestranolMestranol may decrease the anticoagulant activities of Lepirudin.DB04574Estrone sulfateEstrone sulfate may decrease the anticoagulant activities of Lepirudin.DB04575QuinestrolQuinestrol may decrease the anticoagulant activities of Lepirudin.DB07931HexestrolHexestrol may decrease the anticoagulant activities of Lepirudin.DB09317Synthetic Conjugated Estrogens, ASynthetic Conjugated Estrogens, A may decrease the anticoagulant activities of Lepirudin.DB09318Synthetic Conjugated Estrogens, BSynthetic Conjugated Estrogens, B may decrease the anticoagulant activities of Lepirudin.DB09369Polyestradiol phosphatePolyestradiol phosphate may decrease the anticoagulant activities of Lepirudin.DB09381Esterified estrogensEsterified estrogens may decrease the anticoagulant activities of Lepirudin.DB11478ZeranolZeranol may decrease the anticoagulant activities of Lepirudin.DB11674EquolEquol may decrease the anticoagulant activities of Lepirudin.DB13143MethallenestrilMethallenestril may decrease the anticoagulant activities of Lepirudin.DB13386EpimestrolEpimestrol may decrease the anticoagulant activities of Lepirudin.DB13418MoxestrolMoxestrol may decrease the anticoagulant activities of Lepirudin.DB13952Estradiol acetateEstradiol acetate may decrease the anticoagulant activities of Lepirudin.DB13953Estradiol benzoateEstradiol benzoate may decrease the anticoagulant activities of Lepirudin.DB13954Estradiol cypionateEstradiol cypionate may decrease the anticoagulant activities of Lepirudin.DB13956Estradiol valerateEstradiol valerate may decrease the anticoagulant activities of Lepirudin.DB15334Biochanin ABiochanin A may decrease the anticoagulant activities of Lepirudin.DB15335FormononetinFormononetin may decrease the anticoagulant activities of Lepirudin.DB04573EstriolEstriol may decrease the anticoagulant activities of Lepirudin.DB09211LimaprostThe risk or severity of adverse effects can be increased when Limaprost is combined with Lepirudin.DB00159IcosapentThe risk or severity of bleeding and hemorrhage can be increased when Icosapent is combined with Lepirudin.DB00244MesalazineThe risk or severity of bleeding and hemorrhage can be increased when Mesalazine is combined with Lepirudin.DB00328IndomethacinThe risk or severity of bleeding and hemorrhage can be increased when Indomethacin is combined with Lepirudin.DB00461NabumetoneThe risk or severity of bleeding and hemorrhage can be increased when Nabumetone is combined with Lepirudin.DB00465KetorolacThe risk or severity of bleeding and hemorrhage can be increased when Ketorolac is combined with Lepirudin.DB00469TenoxicamThe risk or severity of bleeding and hemorrhage can be increased when Tenoxicam is combined with Lepirudin.DB00482CelecoxibThe risk or severity of bleeding and hemorrhage can be increased when Celecoxib is combined with Lepirudin.DB00500TolmetinThe risk or severity of bleeding and hemorrhage can be increased when Tolmetin is combined with Lepirudin.DB00533RofecoxibThe risk or severity of bleeding and hemorrhage can be increased when Rofecoxib is combined with Lepirudin.DB00554PiroxicamThe risk or severity of bleeding and hemorrhage can be increased when Piroxicam is combined with Lepirudin.DB00573FenoprofenThe risk or severity of bleeding and hemorrhage can be increased when Fenoprofen is combined with Lepirudin.DB00580ValdecoxibThe risk or severity of bleeding and hemorrhage can be increased when Valdecoxib is combined with Lepirudin.DB00586DiclofenacThe risk or severity of bleeding and hemorrhage can be increased when Diclofenac is combined with Lepirudin.DB00605SulindacThe risk or severity of bleeding and hemorrhage can be increased when Sulindac is combined with Lepirudin.DB00712FlurbiprofenThe risk or severity of bleeding and hemorrhage can be increased when Flurbiprofen is combined with Lepirudin.DB00749EtodolacThe risk or severity of bleeding and hemorrhage can be increased when Etodolac is combined with Lepirudin.DB00784Mefenamic acidThe risk or severity of bleeding and hemorrhage can be increased when Mefenamic acid is combined with Lepirudin.DB00788NaproxenThe risk or severity of bleeding and hemorrhage can be increased when Naproxen is combined with Lepirudin.DB00795SulfasalazineThe risk or severity of bleeding and hemorrhage can be increased when Sulfasalazine is combined with Lepirudin.DB00812PhenylbutazoneThe risk or severity of bleeding and hemorrhage can be increased when Phenylbutazone is combined with Lepirudin.DB00814MeloxicamThe risk or severity of bleeding and hemorrhage can be increased when Meloxicam is combined with Lepirudin.DB00821CarprofenThe risk or severity of bleeding and hemorrhage can be increased when Carprofen is combined with Lepirudin.DB00861DiflunisalThe risk or severity of bleeding and hemorrhage can be increased when Diflunisal is combined with Lepirudin.DB00936Salicylic acidThe risk or severity of bleeding and hemorrhage can be increased when Salicylic acid is combined with Lepirudin.DB00939Meclofenamic acidThe risk or severity of bleeding and hemorrhage can be increased when Meclofenamic acid is combined with Lepirudin.DB00991OxaprozinThe risk or severity of bleeding and hemorrhage can be increased when Oxaprozin is combined with Lepirudin.DB01009KetoprofenThe risk or severity of bleeding and hemorrhage can be increased when Ketoprofen is combined with Lepirudin.DB01014BalsalazideThe risk or severity of bleeding and hemorrhage can be increased when Balsalazide is combined with Lepirudin.DB01250OlsalazineThe risk or severity of bleeding and hemorrhage can be increased when Olsalazine is combined with Lepirudin.DB01283LumiracoxibThe risk or severity of bleeding and hemorrhage can be increased when Lumiracoxib is combined with Lepirudin.DB01397Magnesium salicylateThe risk or severity of bleeding and hemorrhage can be increased when Magnesium salicylate is combined with Lepirudin.DB01399SalsalateThe risk or severity of bleeding and hemorrhage can be increased when Salsalate is combined with Lepirudin.DB01401Choline magnesium trisalicylateThe risk or severity of bleeding and hemorrhage can be increased when Choline magnesium trisalicylate is combined with Lepirudin.DB01419AntrafenineThe risk or severity of bleeding and hemorrhage can be increased when Antrafenine is combined with Lepirudin.DB01424AminophenazoneThe risk or severity of bleeding and hemorrhage can be increased when Aminophenazone is combined with Lepirudin.DB01435AntipyrineThe risk or severity of bleeding and hemorrhage can be increased when Antipyrine is combined with Lepirudin.DB01600Tiaprofenic acidThe risk or severity of bleeding and hemorrhage can be increased when Tiaprofenic acid is combined with Lepirudin.DB01628EtoricoxibThe risk or severity of bleeding and hemorrhage can be increased when Etoricoxib is combined with Lepirudin.DB02224TaxifolinThe risk or severity of bleeding and hemorrhage can be increased when Taxifolin is combined with Lepirudin.DB03585OxyphenbutazoneThe risk or severity of bleeding and hemorrhage can be increased when Oxyphenbutazone is combined with Lepirudin.DB04725LicofeloneThe risk or severity of bleeding and hemorrhage can be increased when Licofelone is combined with Lepirudin.DB04812BenoxaprofenThe risk or severity of bleeding and hemorrhage can be increased when Benoxaprofen is combined with Lepirudin.DB04817MetamizoleThe risk or severity of bleeding and hemorrhage can be increased when Metamizole is combined with Lepirudin.DB04828ZomepiracThe risk or severity of bleeding and hemorrhage can be increased when Zomepirac is combined with Lepirudin.DB05095CimicoxibThe risk or severity of bleeding and hemorrhage can be increased when Cimicoxib is combined with Lepirudin.DB06725LornoxicamThe risk or severity of bleeding and hemorrhage can be increased when Lornoxicam is combined with Lepirudin.DB06736AceclofenacThe risk or severity of bleeding and hemorrhage can be increased when Aceclofenac is combined with Lepirudin.DB06737ZaltoprofenThe risk or severity of bleeding and hemorrhage can be increased when Zaltoprofen is combined with Lepirudin.DB07402AzapropazoneThe risk or severity of bleeding and hemorrhage can be increased when Azapropazone is combined with Lepirudin.DB08439ParecoxibThe risk or severity of bleeding and hemorrhage can be increased when Parecoxib is combined with Lepirudin.DB08797SalicylamideThe risk or severity of bleeding and hemorrhage can be increased when Salicylamide is combined with Lepirudin.DB08940KebuzoneThe risk or severity of bleeding and hemorrhage can be increased when Kebuzone is combined with Lepirudin.DB08942IsoxicamThe risk or severity of bleeding and hemorrhage can be increased when Isoxicam is combined with Lepirudin.DB08951IndoprofenThe risk or severity of bleeding and hemorrhage can be increased when Indoprofen is combined with Lepirudin.DB08955IbuproxamThe risk or severity of bleeding and hemorrhage can be increased when Ibuproxam is combined with Lepirudin.DB08976FloctafenineThe risk or severity of bleeding and hemorrhage can be increased when Floctafenine is combined with Lepirudin.DB08981FenbufenThe risk or severity of bleeding and hemorrhage can be increased when Fenbufen is combined with Lepirudin.DB08984EtofenamateThe risk or severity of bleeding and hemorrhage can be increased when Etofenamate is combined with Lepirudin.DB08991EpirizoleThe risk or severity of bleeding and hemorrhage can be increased when Epirizole is combined with Lepirudin.DB09084BenzydamineThe risk or severity of bleeding and hemorrhage can be increased when Benzydamine is combined with Lepirudin.DB09214DexketoprofenThe risk or severity of bleeding and hemorrhage can be increased when Dexketoprofen is combined with Lepirudin.DB09215DroxicamThe risk or severity of bleeding and hemorrhage can be increased when Droxicam is combined with Lepirudin.DB09216Tolfenamic acidThe risk or severity of bleeding and hemorrhage can be increased when Tolfenamic acid is combined with Lepirudin.DB09217FirocoxibThe risk or severity of bleeding and hemorrhage can be increased when Firocoxib is combined with Lepirudin.DB09218ClonixinThe risk or severity of bleeding and hemorrhage can be increased when Clonixin is combined with Lepirudin.DB09285MorniflumateThe risk or severity of bleeding and hemorrhage can be increased when Morniflumate is combined with Lepirudin.DB09288PropacetamolThe risk or severity of bleeding and hemorrhage can be increased when Propacetamol is combined with Lepirudin.DB09295TalniflumateThe risk or severity of bleeding and hemorrhage can be increased when Talniflumate is combined with Lepirudin.DB11455RobenacoxibThe risk or severity of bleeding and hemorrhage can be increased when Robenacoxib is combined with Lepirudin.DB11466TepoxalinThe risk or severity of bleeding and hemorrhage can be increased when Tepoxalin is combined with Lepirudin.DB11518FlunixinThe risk or severity of bleeding and hemorrhage can be increased when Flunixin is combined with Lepirudin.DB12399PolmacoxibThe risk or severity of bleeding and hemorrhage can be increased when Polmacoxib is combined with Lepirudin.DB12610EbselenThe risk or severity of bleeding and hemorrhage can be increased when Ebselen is combined with Lepirudin.DB13001TinoridineThe risk or severity of bleeding and hemorrhage can be increased when Tinoridine is combined with Lepirudin.DB13167AlclofenacThe risk or severity of bleeding and hemorrhage can be increased when Alclofenac is combined with Lepirudin.DB13217FentiazacThe risk or severity of bleeding and hemorrhage can be increased when Fentiazac is combined with Lepirudin.DB13232SuxibuzoneThe risk or severity of bleeding and hemorrhage can be increased when Suxibuzone is combined with Lepirudin.DB13286BumadizoneThe risk or severity of bleeding and hemorrhage can be increased when Bumadizone is combined with Lepirudin.DB13314AlminoprofenThe risk or severity of bleeding and hemorrhage can be increased when Alminoprofen is combined with Lepirudin.DB13371DifenpiramideThe risk or severity of bleeding and hemorrhage can be increased when Difenpiramide is combined with Lepirudin.DB13407NifenazoneThe risk or severity of bleeding and hemorrhage can be increased when Nifenazone is combined with Lepirudin.DB13432LonazolacThe risk or severity of bleeding and hemorrhage can be increased when Lonazolac is combined with Lepirudin.DB13481TenidapThe risk or severity of bleeding and hemorrhage can be increased when Tenidap is combined with Lepirudin.DB13524PropyphenazoneThe risk or severity of bleeding and hemorrhage can be increased when Propyphenazone is combined with Lepirudin.DB13527ProglumetacinThe risk or severity of bleeding and hemorrhage can be increased when Proglumetacin is combined with Lepirudin.DB13538GuacetisalThe risk or severity of bleeding and hemorrhage can be increased when Guacetisal is combined with Lepirudin.DB13544EthenzamideThe risk or severity of bleeding and hemorrhage can be increased when Ethenzamide is combined with Lepirudin.DB13612Carbaspirin calciumThe risk or severity of bleeding and hemorrhage can be increased when Carbaspirin calcium is combined with Lepirudin.DB13629MofebutazoneThe risk or severity of bleeding and hemorrhage can be increased when Mofebutazone is combined with Lepirudin.DB13649ProquazoneThe risk or severity of bleeding and hemorrhage can be increased when Proquazone is combined with Lepirudin.DB13657BenorilateThe risk or severity of bleeding and hemorrhage can be increased when Benorilate is combined with Lepirudin.DB13722PirprofenThe risk or severity of bleeding and hemorrhage can be increased when Pirprofen is combined with Lepirudin.DB13860Imidazole salicylateThe risk or severity of bleeding and hemorrhage can be increased when Imidazole salicylate is combined with Lepirudin.DB14059SC-236The risk or severity of bleeding and hemorrhage can be increased when SC-236 is combined with Lepirudin.DB14060NS-398The risk or severity of bleeding and hemorrhage can be increased when NS-398 is combined with Lepirudin.DB14938Flurbiprofen axetilThe risk or severity of bleeding and hemorrhage can be increased when Flurbiprofen axetil is combined with Lepirudin.DB09212LoxoprofenThe risk or severity of bleeding and hemorrhage can be increased when Loxoprofen is combined with Lepirudin.DB04552Niflumic acidThe risk or severity of bleeding and hemorrhage can be increased when Niflumic acid is combined with Lepirudin.DB04865Omacetaxine mepesuccinateThe risk or severity of bleeding can be increased when Lepirudin is combined with Omacetaxine mepesuccinate.DB11133Omega-3 fatty acidsOmega-3 fatty acids may increase the anticoagulant activities of Lepirudin.DB00081TositumomabThe risk or severity of bleeding and hemorrhage can be increased when Lepirudin is combined with Tositumomab.DB00048Collagenase clostridium histolyticumThe risk or severity of adverse effects can be increased when Lepirudin is combined with Collagenase clostridium histolyticum.DB00389CarbimazoleCarbimazole may increase the anticoagulant activities of Lepirudin.DB00550PropylthiouracilPropylthiouracil may increase the anticoagulant activities of Lepirudin.DB00763MethimazoleMethimazole may increase the anticoagulant activities of Lepirudin.DB033743,5-Diiodotyrosine3,5-Diiodotyrosine may increase the anticoagulant activities of Lepirudin.DB06715Potassium IodidePotassium Iodide may increase the anticoagulant activities of Lepirudin.DB07637DibromotyrosineDibromotyrosine may increase the anticoagulant activities of Lepirudin.DB09418Potassium perchloratePotassium perchlorate may increase the anticoagulant activities of Lepirudin.DB13644MethylthiouracilMethylthiouracil may increase the anticoagulant activities of Lepirudin.DB13804BenzylthiouracilBenzylthiouracil may increase the anticoagulant activities of Lepirudin.DB04066p-Coumaric acidThe therapeutic efficacy of Lepirudin can be decreased when used in combination with p-Coumaric acid.DB04682Octylphenoxy polyethoxyethanolThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Octylphenoxy polyethoxyethanol.DB05830TrestoloneThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Trestolone.DB06266LonidamineThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Lonidamine.DB08867UlipristalThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Ulipristal.DB11507CloprostenolThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cloprostenol.DB12025TriptolideThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Triptolide.DB13044GossypolThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Gossypol.DB00294EtonogestrelThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Etonogestrel.DB00378DydrogesteroneDydrogesterone may decrease the anticoagulant activities of Lepirudin.DB00396ProgesteroneThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Progesterone.DB01431AllylestrenolAllylestrenol may decrease the anticoagulant activities of Lepirudin.DB06713NorelgestrominThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Norelgestromin.DB06789Hydroxyprogesterone caproateThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Hydroxyprogesterone caproate.DB09124MedrogestoneMedrogestone may decrease the anticoagulant activities of Lepirudin.DB11372AltrenogestAltrenogest may decrease the anticoagulant activities of Lepirudin.DB11636NomegestrolThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Nomegestrol.DB13230GestonoroneGestonorone may decrease the anticoagulant activities of Lepirudin.DB13533MethylestrenoloneMethylestrenolone may decrease the anticoagulant activities of Lepirudin.DB13602PromegestonePromegestone may decrease the anticoagulant activities of Lepirudin.DB13866EtynodiolThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Etynodiol.DB14570HydroxyprogesteroneHydroxyprogesterone may decrease the anticoagulant activities of Lepirudin.DB14679Quingestanol acetateQuingestanol acetate may decrease the anticoagulant activities of Lepirudin.DB00233Aminosalicylic acidThe risk or severity of bleeding can be increased when Aminosalicylic acid is combined with Lepirudin.DB01294Bismuth subsalicylateThe risk or severity of bleeding can be increased when Bismuth subsalicylate is combined with Lepirudin.DB06251DersalazineThe risk or severity of bleeding can be increased when Dersalazine is combined with Lepirudin.DB06807Phenyl aminosalicylateThe risk or severity of bleeding can be increased when Phenyl aminosalicylate is combined with Lepirudin.DB09543Methyl salicylateThe risk or severity of bleeding can be increased when Methyl salicylate is combined with Lepirudin.DB11079Trolamine salicylateThe risk or severity of bleeding can be increased when Trolamine salicylate is combined with Lepirudin.DB13509AloxiprinThe risk or severity of bleeding can be increased when Aloxiprin is combined with Lepirudin.DB14006Choline salicylateThe risk or severity of bleeding can be increased when Choline salicylate is combined with Lepirudin.DB14026Thiosalicylic acidThe risk or severity of bleeding can be increased when Thiosalicylic acid is combined with Lepirudin.DB00054AbciximabThe risk or severity of bleeding can be increased when Abciximab is combined with Lepirudin.DB00063EptifibatideThe risk or severity of bleeding can be increased when Eptifibatide is combined with Lepirudin.DB00208TiclopidineThe risk or severity of bleeding can be increased when Ticlopidine is combined with Lepirudin.DB00261AnagrelideThe risk or severity of bleeding can be increased when Anagrelide is combined with Lepirudin.DB00758ClopidogrelThe risk or severity of bleeding can be increased when Clopidogrel is combined with Lepirudin.DB00775TirofibanThe risk or severity of bleeding can be increased when Tirofiban is combined with Lepirudin.DB00975DipyridamoleThe risk or severity of bleeding can be increased when Dipyridamole is combined with Lepirudin.DB01088IloprostThe risk or severity of bleeding can be increased when Iloprost is combined with Lepirudin.DB01138SulfinpyrazoneThe risk or severity of bleeding can be increased when Sulfinpyrazone is combined with Lepirudin.DB01166CilostazolThe risk or severity of bleeding can be increased when Cilostazol is combined with Lepirudin.DB01207RidogrelThe risk or severity of bleeding can be increased when Ridogrel is combined with Lepirudin.DB01236SevofluraneThe risk or severity of bleeding can be increased when Sevoflurane is combined with Lepirudin.DB01240EpoprostenolThe risk or severity of bleeding can be increased when Epoprostenol is combined with Lepirudin.DB02709ResveratrolThe risk or severity of bleeding can be increased when Resveratrol is combined with Lepirudin.DB04743NimesulideThe risk or severity of bleeding and hemorrhage can be increased when Nimesulide is combined with Lepirudin.DB04905TesmilifeneThe risk or severity of bleeding can be increased when Tesmilifene is combined with Lepirudin.DB04932DefibrotideThe risk or severity of bleeding can be increased when Defibrotide is combined with Lepirudin.DB05229BeraprostThe risk or severity of bleeding can be increased when Beraprost is combined with Lepirudin.DB05266IbudilastThe risk or severity of bleeding can be increased when Ibudilast is combined with Lepirudin.DB05767AndrographolideThe risk or severity of bleeding can be increased when Andrographolide is combined with Lepirudin.DB06081CaplacizumabThe risk or severity of bleeding can be increased when Caplacizumab is combined with Lepirudin.DB06209PrasugrelThe risk or severity of bleeding can be increased when Prasugrel is combined with Lepirudin.DB06441CangrelorThe risk or severity of bleeding can be increased when Cangrelor is combined with Lepirudin.DB07615TranilastThe risk or severity of bleeding can be increased when Tranilast is combined with Lepirudin.DB08814TriflusalThe risk or severity of bleeding can be increased when Triflusal is combined with Lepirudin.DB08816TicagrelorThe risk or severity of bleeding can be increased when Ticagrelor is combined with Lepirudin.DB08887Icosapent ethylThe risk or severity of bleeding can be increased when Icosapent ethyl is combined with Lepirudin.DB09283TrapidilThe risk or severity of bleeding can be increased when Trapidil is combined with Lepirudin.DB12092NaftopidilThe risk or severity of bleeding can be increased when Naftopidil is combined with Lepirudin.DB12163SarpogrelateThe risk or severity of bleeding can be increased when Sarpogrelate is combined with Lepirudin.DB12321IfetrobanThe risk or severity of bleeding can be increased when Ifetroban is combined with Lepirudin.DB12445NitroaspirinThe risk or severity of bleeding and hemorrhage can be increased when Nitroaspirin is combined with Lepirudin.DB12465KetanserinThe risk or severity of bleeding can be increased when Ketanserin is combined with Lepirudin.DB12545IndobufenThe risk or severity of bleeding and hemorrhage can be increased when Indobufen is combined with Lepirudin.DB12749ButylphthalideThe risk or severity of bleeding can be increased when Butylphthalide is combined with Lepirudin.DB12771HydroxytyrosolThe risk or severity of bleeding can be increased when Hydroxytyrosol is combined with Lepirudin.DB13036RamatrobanThe risk or severity of bleeding can be increased when Ramatroban is combined with Lepirudin.DB13327PicotamideThe risk or severity of bleeding can be increased when Picotamide is combined with Lepirudin.DB13367CloricromenThe risk or severity of bleeding can be increased when Cloricromen is combined with Lepirudin.DB13400LinsidomineThe risk or severity of bleeding can be increased when Linsidomine is combined with Lepirudin.DB13510BuflomedilThe risk or severity of bleeding can be increased when Buflomedil is combined with Lepirudin.DB13929RelcovaptanThe risk or severity of bleeding can be increased when Relcovaptan is combined with Lepirudin.DB15786Maritime pine extractThe risk or severity of bleeding can be increased when Maritime pine extract is combined with Lepirudin.DB00374TreprostinilThe risk or severity of bleeding can be increased when Treprostinil is combined with Lepirudin.DB03404HeminHemin may increase the anticoagulant activities of Lepirudin.DB13783AcemetacinThe risk or severity of bleeding and hemorrhage can be increased when Lepirudin is combined with Acemetacin.DB00624TestosteroneTestosterone may increase the anticoagulant activities of Lepirudin.DB01420Testosterone propionateTestosterone propionate may increase the anticoagulant activities of Lepirudin.DB014811-Testosterone1-Testosterone may increase the anticoagulant activities of Lepirudin.DB014854-Hydroxytestosterone4-Hydroxytestosterone may increase the anticoagulant activities of Lepirudin.DB01510DehydrochloromethyltestosteroneDehydrochloromethyltestosterone may increase the anticoagulant activities of Lepirudin.DB01541BoldenoneBoldenone may increase the anticoagulant activities of Lepirudin.DB0154318-methyl-19-nortestosterone18-methyl-19-nortestosterone may increase the anticoagulant activities of Lepirudin.DB01564CalusteroneCalusterone may increase the anticoagulant activities of Lepirudin.DB01569FormeboloneFormebolone may increase the anticoagulant activities of Lepirudin.DB01572Methyl-1-testosteroneMethyl-1-testosterone may increase the anticoagulant activities of Lepirudin.DB074475beta-dihydrotestosterone5beta-dihydrotestosterone may increase the anticoagulant activities of Lepirudin.DB08619Testosterone succinateTestosterone succinate may increase the anticoagulant activities of Lepirudin.DB11429MiboleroneMibolerone may increase the anticoagulant activities of Lepirudin.DB13943Testosterone cypionateTestosterone cypionate may increase the anticoagulant activities of Lepirudin.DB13944Testosterone enanthateTestosterone enanthate may increase the anticoagulant activities of Lepirudin.DB13946Testosterone undecanoateTestosterone undecanoate may increase the anticoagulant activities of Lepirudin.DB13947Testosterone enantate benzilic acid hydrazoneTestosterone enantate benzilic acid hydrazone may increase the anticoagulant activities of Lepirudin.DB13951Stanolone acetateStanolone acetate may increase the anticoagulant activities of Lepirudin.DB13958Trestolone acetateTrestolone acetate may increase the anticoagulant activities of Lepirudin.DB14093(1,2,6,7-3H)Testosterone(1,2,6,7-3H)Testosterone may increase the anticoagulant activities of Lepirudin.DB14655Drostanolone propionateDrostanolone propionate may increase the anticoagulant activities of Lepirudin.DB02901StanoloneStanolone may increase the anticoagulant activities of Lepirudin.DB11051Azficel-TThe risk or severity of adverse effects can be increased when Lepirudin is combined with Azficel-T.DB09568Omega-3-carboxylic acidsThe therapeutic efficacy of Lepirudin can be increased when used in combination with Omega-3-carboxylic acids.DB00025Antihemophilic factor, human recombinantThe therapeutic efficacy of Antihemophilic factor, human recombinant can be decreased when used in combination with Lepirudin.DB00036Coagulation factor VIIa Recombinant HumanThe therapeutic efficacy of Coagulation factor VIIa Recombinant Human can be decreased when used in combination with Lepirudin.DB00100Coagulation Factor IX (Recombinant)The therapeutic efficacy of Coagulation Factor IX (Recombinant) can be decreased when used in combination with Lepirudin.DB00258Calcium acetateThe therapeutic efficacy of Calcium acetate can be decreased when used in combination with Lepirudin.DB01164Calcium chlorideThe therapeutic efficacy of Calcium chloride can be decreased when used in combination with Lepirudin.DB01373CalciumThe therapeutic efficacy of Calcium can be decreased when used in combination with Lepirudin.DB01783Pantothenic acidThe therapeutic efficacy of Pantothenic acid can be decreased when used in combination with Lepirudin.DB01942Formic acidThe therapeutic efficacy of Formic acid can be decreased when used in combination with Lepirudin.DB02261Platelet Activating FactorThe therapeutic efficacy of Platelet Activating Factor can be decreased when used in combination with Lepirudin.DB06724Calcium carbonateThe therapeutic efficacy of Calcium carbonate can be decreased when used in combination with Lepirudin.DB09109Turoctocog alfaThe therapeutic efficacy of Turoctocog alfa can be decreased when used in combination with Lepirudin.DB09222Fibrinogen humanThe therapeutic efficacy of Fibrinogen human can be decreased when used in combination with Lepirudin.DB09310CatridecacogThe therapeutic efficacy of Catridecacog can be decreased when used in combination with Lepirudin.DB09329Antihemophilic factor (recombinant), PEGylatedThe therapeutic efficacy of Antihemophilic factor (recombinant), PEGylated can be decreased when used in combination with Lepirudin.DB11093Calcium citrateThe therapeutic efficacy of Calcium citrate can be decreased when used in combination with Lepirudin.DB11126Calcium gluconateThe therapeutic efficacy of Calcium gluconate can be decreased when used in combination with Lepirudin.DB11168Calcium threonateThe therapeutic efficacy of Calcium threonate can be decreased when used in combination with Lepirudin.DB11311ProthrombinThe therapeutic efficacy of Prothrombin can be decreased when used in combination with Lepirudin.DB11330Factor IX Complex (Human)The therapeutic efficacy of Factor IX Complex (Human) can be decreased when used in combination with Lepirudin.DB11348Calcium PhosphateThe therapeutic efficacy of Calcium Phosphate can be decreased when used in combination with Lepirudin.DB11606Susoctocog alfaThe therapeutic efficacy of Susoctocog alfa can be decreased when used in combination with Lepirudin.DB11608Eftrenonacog alfaThe therapeutic efficacy of Eftrenonacog alfa can be decreased when used in combination with Lepirudin.DB11668Rusalatide acetateThe therapeutic efficacy of Rusalatide acetate can be decreased when used in combination with Lepirudin.DB12409Vatreptacog alfaThe therapeutic efficacy of Vatreptacog alfa can be decreased when used in combination with Lepirudin.DB12909Factor XIII (human)The therapeutic efficacy of Factor XIII (human) can be decreased when used in combination with Lepirudin.DB13133Von Willebrand factor humanThe therapeutic efficacy of Von Willebrand factor human can be decreased when used in combination with Lepirudin.DB13148Coagulation factor X humanThe therapeutic efficacy of Coagulation factor X human can be decreased when used in combination with Lepirudin.DB13150Coagulation factor VII humanThe therapeutic efficacy of Coagulation factor VII human can be decreased when used in combination with Lepirudin.DB13151Anti-inhibitor coagulant complexThe therapeutic efficacy of Anti-inhibitor coagulant complex can be decreased when used in combination with Lepirudin.DB13152Coagulation Factor IX HumanThe therapeutic efficacy of Coagulation Factor IX Human can be decreased when used in combination with Lepirudin.DB13192Antihemophilic factor humanThe therapeutic efficacy of Antihemophilic factor human can be decreased when used in combination with Lepirudin.DB13197KallidinogenaseThe therapeutic efficacy of Kallidinogenase can be decreased when used in combination with Lepirudin.DB13201Trenonacog alfaThe therapeutic efficacy of Trenonacog alfa can be decreased when used in combination with Lepirudin.DB13884Albutrepenonacog alfaThe therapeutic efficacy of Albutrepenonacog alfa can be decreased when used in combination with Lepirudin.DB13923EmicizumabThe therapeutic efficacy of Emicizumab can be decreased when used in combination with Lepirudin.DB13933Nonacog beta pegolThe therapeutic efficacy of Nonacog beta pegol can be decreased when used in combination with Lepirudin.DB13999Moroctocog alfaThe therapeutic efficacy of Moroctocog alfa can be decreased when used in combination with Lepirudin.DB14473Beroctocog alfaThe therapeutic efficacy of Beroctocog alfa can be decreased when used in combination with Lepirudin.DB14562Andexanet alfaThe therapeutic efficacy of Andexanet alfa can be decreased when used in combination with Lepirudin.DB14577Calcium cationThe therapeutic efficacy of Calcium cation can be decreased when used in combination with Lepirudin.DB14700Damoctocog alfa pegolThe therapeutic efficacy of Damoctocog alfa pegol can be decreased when used in combination with Lepirudin.DB14738Turoctocog alfa pegolThe therapeutic efficacy of Turoctocog alfa pegol can be decreased when used in combination with Lepirudin.DB00176FluvoxamineThe risk or severity of hemorrhage can be increased when Fluvoxamine is combined with Lepirudin.DB00215CitalopramThe risk or severity of hemorrhage can be increased when Citalopram is combined with Lepirudin.DB00472FluoxetineThe risk or severity of hemorrhage can be increased when Fluoxetine is combined with Lepirudin.DB00715ParoxetineThe risk or severity of hemorrhage can be increased when Paroxetine is combined with Lepirudin.DB01149NefazodoneThe risk or severity of hemorrhage can be increased when Nefazodone is combined with Lepirudin.DB04832ZimelidineThe risk or severity of hemorrhage can be increased when Zimelidine is combined with Lepirudin.DB04884DapoxetineThe risk or severity of hemorrhage can be increased when Dapoxetine is combined with Lepirudin.DB06731SeproxetineThe risk or severity of hemorrhage can be increased when Seproxetine is combined with Lepirudin.DB08953IndalpineThe risk or severity of hemorrhage can be increased when Indalpine is combined with Lepirudin.DB12693RitanserinThe risk or severity of hemorrhage can be increased when Ritanserin is combined with Lepirudin.DB13233AlaproclateThe risk or severity of hemorrhage can be increased when Alaproclate is combined with Lepirudin.DB00476DuloxetineThe risk or severity of hemorrhage can be increased when Duloxetine is combined with Lepirudin.DB01105SibutramineThe risk or severity of hemorrhage can be increased when Sibutramine is combined with Lepirudin.DB04896MilnacipranThe risk or severity of hemorrhage can be increased when Milnacipran is combined with Lepirudin.DB06700DesvenlafaxineThe risk or severity of hemorrhage can be increased when Desvenlafaxine is combined with Lepirudin.DB08918LevomilnacipranThe risk or severity of hemorrhage can be increased when Levomilnacipran is combined with Lepirudin.DB00285VenlafaxineVenlafaxine may increase the antiplatelet activities of Lepirudin.DB00601LinezolidThe risk or severity of bleeding and hemorrhage can be increased when Linezolid is combined with Lepirudin.DB00614FurazolidoneThe risk or severity of bleeding and hemorrhage can be increased when Furazolidone is combined with Lepirudin.DB00721ProcaineThe risk or severity of bleeding and hemorrhage can be increased when Procaine is combined with Lepirudin.DB00752TranylcypromineThe risk or severity of bleeding and hemorrhage can be increased when Tranylcypromine is combined with Lepirudin.DB00780PhenelzineThe risk or severity of bleeding and hemorrhage can be increased when Phenelzine is combined with Lepirudin.DB00805MinaprineThe risk or severity of bleeding and hemorrhage can be increased when Minaprine is combined with Lepirudin.DB01037SelegilineThe risk or severity of bleeding and hemorrhage can be increased when Selegiline is combined with Lepirudin.DB01168ProcarbazineThe risk or severity of bleeding and hemorrhage can be increased when Procarbazine is combined with Lepirudin.DB01171MoclobemideThe risk or severity of bleeding and hemorrhage can be increased when Moclobemide is combined with Lepirudin.DB01247IsocarboxazidThe risk or severity of bleeding and hemorrhage can be increased when Isocarboxazid is combined with Lepirudin.DB01367RasagilineThe risk or severity of bleeding and hemorrhage can be increased when Rasagiline is combined with Lepirudin.DB01626PargylineThe risk or severity of bleeding and hemorrhage can be increased when Pargyline is combined with Lepirudin.DB04017ClorgilineThe risk or severity of bleeding and hemorrhage can be increased when Clorgiline is combined with Lepirudin.DB04818IproniazidThe risk or severity of bleeding and hemorrhage can be increased when Iproniazid is combined with Lepirudin.DB04820NialamideThe risk or severity of bleeding and hemorrhage can be increased when Nialamide is combined with Lepirudin.DB06654SafinamideThe risk or severity of bleeding and hemorrhage can be increased when Safinamide is combined with Lepirudin.DB085507,8-Dichloro-1,2,3,4-tetrahydroisoquinolineThe risk or severity of bleeding and hemorrhage can be increased when 7,8-Dichloro-1,2,3,4-tetrahydroisoquinoline is combined with Lepirudin.DB09241Methylene blueThe risk or severity of bleeding and hemorrhage can be increased when Methylene blue is combined with Lepirudin.DB09243HydracarbazineThe risk or severity of bleeding and hemorrhage can be increased when Hydracarbazine is combined with Lepirudin.DB09244PirlindoleThe risk or severity of bleeding and hemorrhage can be increased when Pirlindole is combined with Lepirudin.DB09245ToloxatoneThe risk or severity of bleeding and hemorrhage can be increased when Toloxatone is combined with Lepirudin.DB09246BenmoxinThe risk or severity of bleeding and hemorrhage can be increased when Benmoxin is combined with Lepirudin.DB09248MebanazineThe risk or severity of bleeding and hemorrhage can be increased when Mebanazine is combined with Lepirudin.DB09249OctamoxinThe risk or severity of bleeding and hemorrhage can be increased when Octamoxin is combined with Lepirudin.DB09250PheniprazineThe risk or severity of bleeding and hemorrhage can be increased when Pheniprazine is combined with Lepirudin.DB09251PhenoxypropazineThe risk or severity of bleeding and hemorrhage can be increased when Phenoxypropazine is combined with Lepirudin.DB09252PivhydrazineThe risk or severity of bleeding and hemorrhage can be increased when Pivhydrazine is combined with Lepirudin.DB09253SafrazineThe risk or severity of bleeding and hemorrhage can be increased when Safrazine is combined with Lepirudin.DB09254CaroxazoneThe risk or severity of bleeding and hemorrhage can be increased when Caroxazone is combined with Lepirudin.DB13875HarmalineThe risk or severity of bleeding and hemorrhage can be increased when Harmaline is combined with Lepirudin.DB13876BrofaromineThe risk or severity of bleeding and hemorrhage can be increased when Brofaromine is combined with Lepirudin.DB00006BivalirudinThe risk or severity of bleeding can be increased when Lepirudin is combined with Bivalirudin.DB00266DicoumarolThe risk or severity of bleeding can be increased when Lepirudin is combined with Dicoumarol.DB00278ArgatrobanThe risk or severity of bleeding can be increased when Lepirudin is combined with Argatroban.DB00407ArdeparinThe risk or severity of bleeding can be increased when Lepirudin is combined with Ardeparin.DB00498PhenindioneThe risk or severity of bleeding can be increased when Lepirudin is combined with Phenindione.DB00569FondaparinuxThe risk or severity of bleeding can be increased when Lepirudin is combined with Fondaparinux.DB00682WarfarinThe risk or severity of bleeding can be increased when Lepirudin is combined with Warfarin.DB00946PhenprocoumonThe risk or severity of bleeding can be increased when Lepirudin is combined with Phenprocoumon.DB00974Edetic acidThe risk or severity of bleeding can be increased when Lepirudin is combined with Edetic acid.DB01109HeparinThe risk or severity of bleeding can be increased when Lepirudin is combined with Heparin.DB01225EnoxaparinThe risk or severity of bleeding can be increased when Lepirudin is combined with Enoxaparin.DB01418AcenocoumarolThe risk or severity of bleeding can be increased when Lepirudin is combined with Acenocoumarol.DB04898XimelagatranThe risk or severity of bleeding can be increased when Lepirudin is combined with Ximelagatran.DB05099AncrodThe risk or severity of bleeding can be increased when Lepirudin is combined with Ancrod.DB06271SulodexideThe risk or severity of bleeding can be increased when Lepirudin is combined with Sulodexide.DB06406IdraparinuxThe risk or severity of bleeding can be increased when Lepirudin is combined with Idraparinux.DB06635OtamixabanThe risk or severity of bleeding can be increased when Lepirudin is combined with Otamixaban.DB06754DanaparoidThe risk or severity of bleeding can be increased when Lepirudin is combined with Danaparoid.DB06779DalteparinThe risk or severity of bleeding can be increased when Lepirudin is combined with Dalteparin.DB07767Ferulic acidThe risk or severity of bleeding can be increased when Lepirudin is combined with Ferulic acid.DB08794Ethyl biscoumacetateThe risk or severity of bleeding can be increased when Lepirudin is combined with Ethyl biscoumacetate.DB08813NadroparinThe risk or severity of bleeding can be increased when Lepirudin is combined with Nadroparin.DB09255DextranThe risk or severity of bleeding can be increased when Lepirudin is combined with Dextran.DB11095DesirudinThe risk or severity of bleeding can be increased when Lepirudin is combined with Desirudin.DB11268ProtocatechualdehydeThe risk or severity of bleeding can be increased when Lepirudin is combined with Protocatechualdehyde.DB11312Protein CThe risk or severity of bleeding can be increased when Lepirudin is combined with Protein C.DB11598Antithrombin III humanThe risk or severity of bleeding can be increased when Lepirudin is combined with Antithrombin III human.DB11984LetaxabanThe risk or severity of bleeding can be increased when Lepirudin is combined with Letaxaban.DB12289DarexabanThe risk or severity of bleeding can be increased when Lepirudin is combined with Darexaban.DB12598NafamostatThe risk or severity of bleeding can be increased when Lepirudin is combined with Nafamostat.DB12831GabexateThe risk or severity of bleeding can be increased when Lepirudin is combined with Gabexate.DB13124TroxerutinThe risk or severity of bleeding can be increased when Lepirudin is combined with Troxerutin.DB13136FluindioneThe risk or severity of bleeding can be increased when Lepirudin is combined with Fluindione.DB13149Protein S humanThe risk or severity of bleeding can be increased when Lepirudin is combined with Protein S human.DB13616MelagatranThe risk or severity of bleeding can be increased when Lepirudin is combined with Melagatran.DB09125Potassium citrateThe risk or severity of bleeding can be increased when Lepirudin is combined with Potassium citrate.DB09154Sodium citrateThe risk or severity of bleeding can be increased when Lepirudin is combined with Sodium citrate.DB00031TenecteplaseThe risk or severity of bleeding can be increased when Lepirudin is combined with Tenecteplase.DB00055Drotrecogin alfaThe risk or severity of bleeding can be increased when Lepirudin is combined with Drotrecogin alfa.DB06822TinzaparinThe risk or severity of bleeding can be increased when Lepirudin is combined with Tinzaparin.DB13199BrinaseThe risk or severity of bleeding can be increased when Lepirudin is combined with Brinase.DB13646SaruplaseThe risk or severity of bleeding can be increased when Lepirudin is combined with Saruplase.DB00086StreptokinaseThe risk or severity of bleeding can be increased when Lepirudin is combined with Streptokinase.DB04925DesmoteplaseThe risk or severity of bleeding can be increased when Lepirudin is combined with Desmoteplase.DB05254FibrinolysinThe risk or severity of bleeding can be increased when Lepirudin is combined with Fibrinolysin.DB06543AstaxanthinThe risk or severity of bleeding can be increased when Lepirudin is combined with Astaxanthin.DB08994DitazoleThe risk or severity of bleeding can be increased when Lepirudin is combined with Ditazole.DB09258BemiparinThe risk or severity of bleeding can be increased when Lepirudin is combined with Bemiparin.DB09260ParnaparinThe risk or severity of bleeding can be increased when Lepirudin is combined with Parnaparin.DB13275ClorindioneThe risk or severity of bleeding can be increased when Lepirudin is combined with Clorindione.DB13347DiphenadioneThe risk or severity of bleeding can be increased when Lepirudin is combined with Diphenadione.DB13451TioclomarolThe risk or severity of bleeding can be increased when Lepirudin is combined with Tioclomarol.DB00009AlteplaseThe risk or severity of bleeding can be increased when Lepirudin is combined with Alteplase.DB00015ReteplaseThe risk or severity of bleeding can be increased when Lepirudin is combined with Reteplase.DB00029AnistreplaseThe risk or severity of bleeding can be increased when Lepirudin is combined with Anistreplase.DB14094TocopherylquinoneThe risk or severity of bleeding can be increased when Lepirudin is combined with Tocopherylquinone.DB06679AmediplaseThe risk or severity of bleeding can be increased when Lepirudin is combined with Amediplase.DB034104-hydroxycoumarinThe risk or severity of bleeding can be increased when Lepirudin is combined with 4-hydroxycoumarin.DB08496(R)-warfarinThe risk or severity of bleeding can be increased when Lepirudin is combined with (R)-warfarin.DB14055(S)-WarfarinThe risk or severity of bleeding can be increased when Lepirudin is combined with (S)-Warfarin.DB12364BetrixabanThe risk or severity of bleeding can be increased when Lepirudin is combined with Betrixaban.DB14598Edetate calcium disodium anhydrousThe risk or severity of bleeding can be increased when Lepirudin is combined with Edetate calcium disodium anhydrous.DB11154Zinc citrateThe risk or severity of bleeding can be increased when Lepirudin is combined with Zinc citrate.DB11166Antithrombin AlfaThe risk or severity of bleeding can be increased when Lepirudin is combined with Antithrombin Alfa.DB04665CoumarinThe risk or severity of bleeding can be increased when Lepirudin is combined with Coumarin.DB14726DabigatranThe risk or severity of bleeding can be increased when Lepirudin is combined with Dabigatran.DB06294SemuloparinThe risk or severity of bleeding can be increased when Lepirudin is combined with Semuloparin.DB12726MonteplaseThe risk or severity of bleeding can be increased when Lepirudin is combined with Monteplase.DB09259ReviparinThe risk or severity of bleeding can be increased when Lepirudin is combined with Reviparin.DB15880Dermatan sulfateThe risk or severity of bleeding can be increased when Lepirudin is combined with Dermatan sulfate.DB05361SR-123781AThe risk or severity of bleeding can be increased when Lepirudin is combined with SR-123781A.DB16481Dociparstat sodiumThe risk or severity of bleeding can be increased when Lepirudin is combined with Dociparstat sodium.DB00203SildenafilThe risk or severity of hemorrhage can be increased when Lepirudin is combined with Sildenafil.DB00008Peginterferon alfa-2aThe risk or severity of bleeding can be increased when Lepirudin is combined with Peginterferon alfa-2a.DB00011Interferon alfa-n1The risk or severity of bleeding can be increased when Lepirudin is combined with Interferon alfa-n1.DB00018Interferon alfa-n3The risk or severity of bleeding can be increased when Lepirudin is combined with Interferon alfa-n3.DB00022Peginterferon alfa-2bThe risk or severity of bleeding can be increased when Lepirudin is combined with Peginterferon alfa-2b.DB00033Interferon gamma-1bThe risk or severity of bleeding can be increased when Lepirudin is combined with Interferon gamma-1b.DB00034Interferon alfa-2aThe risk or severity of bleeding can be increased when Lepirudin is combined with Interferon alfa-2a.DB00041AldesleukinThe risk or severity of bleeding can be increased when Lepirudin is combined with Aldesleukin.DB00056Gemtuzumab ozogamicinThe risk or severity of bleeding can be increased when Lepirudin is combined with Gemtuzumab ozogamicin.DB00068Interferon beta-1bThe risk or severity of bleeding can be increased when Lepirudin is combined with Interferon beta-1b.DB00069Interferon alfacon-1The risk or severity of bleeding can be increased when Lepirudin is combined with Interferon alfacon-1.DB00073RituximabThe risk or severity of bleeding can be increased when Lepirudin is combined with Rituximab.DB00078Ibritumomab tiuxetanThe risk or severity of bleeding can be increased when Lepirudin is combined with Ibritumomab tiuxetan.DB00087AlemtuzumabThe risk or severity of bleeding can be increased when Lepirudin is combined with Alemtuzumab.DB00105Interferon alfa-2bThe risk or severity of bleeding can be increased when Lepirudin is combined with Interferon alfa-2b.DB00120PhenylalanineThe risk or severity of bleeding can be increased when Lepirudin is combined with Phenylalanine.DB00188BortezomibThe risk or severity of bleeding can be increased when Lepirudin is combined with Bortezomib.DB00242CladribineThe risk or severity of bleeding can be increased when Lepirudin is combined with Cladribine.DB00262CarmustineThe risk or severity of bleeding can be increased when Lepirudin is combined with Carmustine.DB00276AmsacrineThe risk or severity of bleeding can be increased when Lepirudin is combined with Amsacrine.DB00291ChlorambucilThe risk or severity of bleeding can be increased when Lepirudin is combined with Chlorambucil.DB00293RaltitrexedThe risk or severity of bleeding can be increased when Lepirudin is combined with Raltitrexed.DB00305MitomycinThe risk or severity of bleeding can be increased when Lepirudin is combined with Mitomycin.DB00307BexaroteneThe risk or severity of bleeding can be increased when Lepirudin is combined with Bexarotene.DB00309VindesineThe risk or severity of bleeding can be increased when Lepirudin is combined with Vindesine.DB00322FloxuridineThe risk or severity of bleeding can be increased when Lepirudin is combined with Floxuridine.DB00352TioguanineThe risk or severity of bleeding can be increased when Lepirudin is combined with Tioguanine.DB00361VinorelbineThe risk or severity of bleeding can be increased when Lepirudin is combined with Vinorelbine.DB00380DexrazoxaneThe risk or severity of bleeding can be increased when Lepirudin is combined with Dexrazoxane.DB00398SorafenibThe risk or severity of bleeding can be increased when Lepirudin is combined with Sorafenib.DB00428StreptozocinThe risk or severity of bleeding can be increased when Lepirudin is combined with Streptozocin.DB00441GemcitabineThe risk or severity of bleeding can be increased when Lepirudin is combined with Gemcitabine.DB00444TeniposideThe risk or severity of bleeding can be increased when Lepirudin is combined with Teniposide.DB00445EpirubicinThe risk or severity of bleeding can be increased when Lepirudin is combined with Epirubicin.DB00446ChloramphenicolThe risk or severity of bleeding can be increased when Lepirudin is combined with Chloramphenicol.DB00480LenalidomideThe risk or severity of bleeding can be increased when Lepirudin is combined with Lenalidomide.DB00488AltretamineThe risk or severity of bleeding can be increased when Lepirudin is combined with Altretamine.DB00495ZidovudineThe risk or severity of bleeding can be increased when Lepirudin is combined with Zidovudine.DB00515CisplatinThe risk or severity of bleeding can be increased when Lepirudin is combined with Cisplatin.DB00526OxaliplatinThe risk or severity of bleeding can be increased when Lepirudin is combined with Oxaliplatin.DB00531CyclophosphamideThe risk or severity of bleeding can be increased when Lepirudin is combined with Cyclophosphamide.DB00544FluorouracilThe risk or severity of bleeding can be increased when Lepirudin is combined with Fluorouracil.DB00552PentostatinThe risk or severity of bleeding can be increased when Lepirudin is combined with Pentostatin.DB00563MethotrexateThe risk or severity of bleeding can be increased when Lepirudin is combined with Methotrexate.DB00564CarbamazepineThe risk or severity of bleeding can be increased when Lepirudin is combined with Carbamazepine.DB00570VinblastineThe risk or severity of bleeding can be increased when Lepirudin is combined with Vinblastine.DB00619ImatinibThe risk or severity of bleeding can be increased when Lepirudin is combined with Imatinib.DB00631ClofarabineThe risk or severity of bleeding can be increased when Lepirudin is combined with Clofarabine.DB00642PemetrexedThe risk or severity of bleeding can be increased when Lepirudin is combined with Pemetrexed.DB00694DaunorubicinThe risk or severity of bleeding can be increased when Lepirudin is combined with Daunorubicin.DB00762IrinotecanThe risk or severity of bleeding can be increased when Lepirudin is combined with Irinotecan.DB00773EtoposideThe risk or severity of bleeding can be increased when Lepirudin is combined with Etoposide.DB00851DacarbazineThe risk or severity of bleeding can be increased when Lepirudin is combined with Dacarbazine.DB00853TemozolomideThe risk or severity of bleeding can be increased when Lepirudin is combined with Temozolomide.DB00859PenicillamineThe risk or severity of bleeding can be increased when Lepirudin is combined with Penicillamine.DB00864TacrolimusThe risk or severity of bleeding can be increased when Lepirudin is combined with Tacrolimus.DB00877SirolimusThe risk or severity of bleeding can be increased when Lepirudin is combined with Sirolimus.DB00888MechlorethamineThe risk or severity of bleeding can be increased when Lepirudin is combined with Mechlorethamine.DB00928AzacitidineThe risk or severity of bleeding can be increased when Lepirudin is combined with Azacitidine.DB00958CarboplatinThe risk or severity of bleeding can be increased when Lepirudin is combined with Carboplatin.DB00970DactinomycinThe risk or severity of bleeding can be increased when Lepirudin is combined with Dactinomycin.DB00987CytarabineThe risk or severity of bleeding can be increased when Lepirudin is combined with Cytarabine.DB00997DoxorubicinThe risk or severity of bleeding can be increased when Lepirudin is combined with Doxorubicin.DB01005HydroxyureaThe risk or severity of bleeding can be increased when Lepirudin is combined with Hydroxyurea.DB01008BusulfanThe risk or severity of bleeding can be increased when Lepirudin is combined with Busulfan.DB01030TopotecanThe risk or severity of bleeding can be increased when Lepirudin is combined with Topotecan.DB01033MercaptopurineThe risk or severity of bleeding can be increased when Lepirudin is combined with Mercaptopurine.DB01041ThalidomideThe risk or severity of bleeding can be increased when Lepirudin is combined with Thalidomide.DB01042MelphalanThe risk or severity of bleeding can be increased when Lepirudin is combined with Melphalan.DB01073FludarabineThe risk or severity of bleeding can be increased when Lepirudin is combined with Fludarabine.DB01099FlucytosineThe risk or severity of bleeding can be increased when Lepirudin is combined with Flucytosine.DB01101CapecitabineThe risk or severity of bleeding can be increased when Lepirudin is combined with Capecitabine.DB01169Arsenic trioxideThe risk or severity of bleeding can be increased when Lepirudin is combined with Arsenic trioxide.DB01177IdarubicinThe risk or severity of bleeding can be increased when Lepirudin is combined with Idarubicin.DB01204MitoxantroneThe risk or severity of bleeding can be increased when Lepirudin is combined with Mitoxantrone.DB01206LomustineThe risk or severity of bleeding can be increased when Lepirudin is combined with Lomustine.DB01229PaclitaxelThe risk or severity of bleeding can be increased when Lepirudin is combined with Paclitaxel.DB01248DocetaxelThe risk or severity of bleeding can be increased when Lepirudin is combined with Docetaxel.DB01262DecitabineThe risk or severity of bleeding can be increased when Lepirudin is combined with Decitabine.DB01280NelarabineThe risk or severity of bleeding can be increased when Lepirudin is combined with Nelarabine.DB01590EverolimusThe risk or severity of bleeding can be increased when Lepirudin is combined with Everolimus.DB02546VorinostatThe risk or severity of bleeding can be increased when Lepirudin is combined with Vorinostat.DB04572ThiotepaThe risk or severity of bleeding can be increased when Lepirudin is combined with Thiotepa.DB04845IxabepiloneThe risk or severity of bleeding can be increased when Lepirudin is combined with Ixabepilone.DB04868NilotinibThe risk or severity of bleeding can be increased when Lepirudin is combined with Nilotinib.DB05015BelinostatThe risk or severity of bleeding can be increased when Lepirudin is combined with Belinostat.DB05109TrabectedinThe risk or severity of bleeding can be increased when Lepirudin is combined with Trabectedin.DB05258Interferon alfaThe risk or severity of bleeding can be increased when Lepirudin is combined with Interferon alfa.DB05472Human interferon omega-1The risk or severity of bleeding can be increased when Lepirudin is combined with Human interferon omega-1.DB05773Trastuzumab emtansineThe risk or severity of bleeding can be increased when Lepirudin is combined with Trastuzumab emtansine.DB06287TemsirolimusThe risk or severity of bleeding can be increased when Lepirudin is combined with Temsirolimus.DB06616BosutinibThe risk or severity of bleeding can be increased when Lepirudin is combined with Bosutinib.DB06769BendamustineThe risk or severity of bleeding can be increased when Lepirudin is combined with Bendamustine.DB06772CabazitaxelThe risk or severity of bleeding can be increased when Lepirudin is combined with Cabazitaxel.DB08871EribulinThe risk or severity of bleeding can be increased when Lepirudin is combined with Eribulin.DB08877RuxolitinibThe risk or severity of bleeding can be increased when Lepirudin is combined with Ruxolitinib.DB08889CarfilzomibThe risk or severity of bleeding can be increased when Lepirudin is combined with Carfilzomib.DB08895TofacitinibThe risk or severity of bleeding can be increased when Lepirudin is combined with Tofacitinib.DB08901PonatinibThe risk or severity of bleeding can be increased when Lepirudin is combined with Ponatinib.DB08910PomalidomideThe risk or severity of bleeding can be increased when Lepirudin is combined with Pomalidomide.DB09042Tedizolid phosphateThe risk or severity of bleeding can be increased when Lepirudin is combined with Tedizolid phosphate.DB09052BlinatumomabThe risk or severity of bleeding can be increased when Lepirudin is combined with Blinatumomab.DB09073PalbociclibThe risk or severity of bleeding can be increased when Lepirudin is combined with Palbociclib.DB09074OlaparibThe risk or severity of bleeding can be increased when Lepirudin is combined with Olaparib.DB09077DinutuximabThe risk or severity of bleeding can be increased when Lepirudin is combined with Dinutuximab.DB09122Peginterferon beta-1aThe risk or severity of bleeding can be increased when Lepirudin is combined with Peginterferon beta-1a.DB12814Cepeginterferon alfa-2BThe risk or severity of bleeding can be increased when Lepirudin is combined with Cepeginterferon alfa-2B.DB00229CefotiamThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefotiam.DB00267CefmenoximeThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefmenoxime.DB00274CefmetazoleThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefmetazole.DB00430CefpiramideThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefpiramide.DB00438CeftazidimeThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Ceftazidime.DB00447LoracarbefThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Loracarbef.DB00456CefalotinThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefalotin.DB00493CefotaximeThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefotaxime.DB00535CefdinirThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefdinir.DB00567CephalexinThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cephalexin.DB00671CefiximeThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefixime.DB00689CephaloglycinThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cephaloglycin.DB00833CefaclorThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefaclor.DB00923CeforanideThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Ceforanide.DB01066CefditorenThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefditoren.DB01112CefuroximeThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefuroxime.DB01139CefapirinThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefapirin.DB01140CefadroxilThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefadroxil.DB01150CefprozilThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefprozil.DB01212CeftriaxoneThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Ceftriaxone.DB01326CefamandoleThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefamandole.DB01327CefazolinThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefazolin.DB01328CefonicidThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefonicid.DB01329CefoperazoneThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefoperazone.DB01330CefotetanThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefotetan.DB01331CefoxitinThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefoxitin.DB01332CeftizoximeThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Ceftizoxime.DB01333CefradineThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefradine.DB01413CefepimeThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefepime.DB01414CefacetrileThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefacetrile.DB01415CeftibutenThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Ceftibuten.DB01416CefpodoximeThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefpodoxime.DB04570LatamoxefThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Latamoxef.DB04918CeftobiproleThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Ceftobiprole.DB06590Ceftaroline fosamilThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Ceftaroline fosamil.DB09008CefaloridineThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefaloridine.DB09050CeftolozaneThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Ceftolozane.DB09062CefminoxThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefminox.DB11367CefroxadineThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefroxadine.DB11935FlomoxefThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Flomoxef.DB13266CefatrizineThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefatrizine.DB13461CefcapeneThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefcapene.DB13470CefodizimeThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefodizime.DB13499CefsulodinThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefsulodin.DB13504CefetametThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefetamet.DB13638CefbuperazoneThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefbuperazone.DB13667CefozopranThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefozopran.DB13682CefpiromeThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefpirome.DB13778CefazedoneThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefazedone.DB13821CeftezoleThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Ceftezole.DB14725Cefamandole nafateThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cefamandole nafate.DB00254DoxycyclineThe risk or severity of bleeding can be increased when Doxycycline is combined with Lepirudin.DB00207AzithromycinThe risk or severity of adverse effects can be increased when Azithromycin is combined with Lepirudin.DB09539Omega-3-acid ethyl estersThe risk or severity of bleeding can be increased when Omega-3-acid ethyl esters is combined with Lepirudin.DB00945Acetylsalicylic acidAcetylsalicylic acid may increase the anticoagulant activities of Lepirudin.DB01606TazobactamThe risk or severity of bleeding can be increased when Tazobactam is combined with Lepirudin.DB00199ErythromycinThe risk or severity of bleeding can be increased when Erythromycin is combined with Lepirudin.DB00656TrazodoneThe risk or severity of bleeding can be increased when Trazodone is combined with Lepirudin.DB00620TriamcinoloneThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Triamcinolone.DB09079NintedanibThe risk or severity of bleeding can be increased when Nintedanib is combined with Lepirudin.DB01175EscitalopramThe risk or severity of bleeding can be increased when Escitalopram is combined with Lepirudin.DB01104SertralineThe risk or severity of bleeding can be increased when Sertraline is combined with Lepirudin.DB00232MethyclothiazideThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Methyclothiazide.DB00436BendroflumethiazideThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Bendroflumethiazide.DB00562BenzthiazideThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Benzthiazide.DB00606CyclothiazideThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cyclothiazide.DB00774HydroflumethiazideThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Hydroflumethiazide.DB00880ChlorothiazideThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Chlorothiazide.DB00999HydrochlorothiazideThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Hydrochlorothiazide.DB01021TrichlormethiazideThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Trichlormethiazide.DB01324PolythiazideThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Polythiazide.DB13430MebutizideThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Mebutizide.DB13532CyclopenthiazideThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Cyclopenthiazide.DB15861ButhiazideThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Buthiazide.DB00783EstradiolThe risk or severity of adverse effects can be increased when Estradiol is combined with Lepirudin.DB00977EthinylestradiolThe risk or severity of adverse effects can be increased when Ethinylestradiol is combined with Lepirudin.DB00834MifepristoneThe risk or severity of adverse effects can be increased when Mifepristone is combined with Lepirudin.DB13310OrmeloxifeneThe risk or severity of adverse effects can be increased when Ormeloxifene is combined with Lepirudin.DB00304DesogestrelThe risk or severity of adverse effects can be increased when Desogestrel is combined with Lepirudin.DB00351Megestrol acetateThe risk or severity of adverse effects can be increased when Megestrol acetate is combined with Lepirudin.DB00367LevonorgestrelThe risk or severity of adverse effects can be increased when Levonorgestrel is combined with Lepirudin.DB00603Medroxyprogesterone acetateThe risk or severity of adverse effects can be increased when Medroxyprogesterone acetate is combined with Lepirudin.DB00717NorethisteroneThe risk or severity of adverse effects can be increased when Norethisterone is combined with Lepirudin.DB00823Ethynodiol diacetateThe risk or severity of adverse effects can be increased when Ethynodiol diacetate is combined with Lepirudin.DB00957NorgestimateThe risk or severity of adverse effects can be increased when Norgestimate is combined with Lepirudin.DB01395DrospirenoneThe risk or severity of adverse effects can be increased when Drospirenone is combined with Lepirudin.DB04839Cyproterone acetateThe risk or severity of adverse effects can be increased when Cyproterone acetate is combined with Lepirudin.DB06730GestodeneThe risk or severity of adverse effects can be increased when Gestodene is combined with Lepirudin.DB09123DienogestThe risk or severity of adverse effects can be increased when Dienogest is combined with Lepirudin.DB09371NorethynodrelThe risk or severity of adverse effects can be increased when Norethynodrel is combined with Lepirudin.DB09389NorgestrelThe risk or severity of adverse effects can be increased when Norgestrel is combined with Lepirudin.DB11619GestrinoneThe risk or severity of adverse effects can be increased when Gestrinone is combined with Lepirudin.DB12474LynestrenolThe risk or severity of adverse effects can be increased when Lynestrenol is combined with Lepirudin.DB13528ChlormadinoneThe risk or severity of adverse effects can be increased when Chlormadinone is combined with Lepirudin.DB13563NorgestrienoneThe risk or severity of adverse effects can be increased when Norgestrienone is combined with Lepirudin.DB13685QuingestanolThe risk or severity of adverse effects can be increased when Quingestanol is combined with Lepirudin.DB13857DemegestoneThe risk or severity of adverse effects can be increased when Demegestone is combined with Lepirudin.DB13981Nomegestrol acetateThe risk or severity of adverse effects can be increased when Nomegestrol acetate is combined with Lepirudin.DB14678Norethindrone enanthateThe risk or severity of adverse effects can be increased when Norethindrone enanthate is combined with Lepirudin.DB15775Algestone acetophenideThe risk or severity of adverse effects can be increased when Algestone acetophenide is combined with Lepirudin.DB15903Chlormadinone acetateThe risk or severity of adverse effects can be increased when Chlormadinone acetate is combined with Lepirudin.DB12235EstetrolThe risk or severity of adverse effects can be increased when Estetrol is combined with Lepirudin.DB11201Menthyl salicylateThe risk or severity of bleeding and hemorrhage can be increased when Menthyl salicylate is combined with Lepirudin.DB11323Glycol salicylateThe risk or severity of bleeding and hemorrhage can be increased when Glycol salicylate is combined with Lepirudin.DB15119Ropeginterferon alfa-2bThe risk or severity of bleeding can be increased when Lepirudin is combined with Ropeginterferon alfa-2b.>DB00001 sequence
LVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIP
EEYLQMelting Point65 °COtto, A. & Seckler, R. Eur. J. Biochem. 202:67-73 (1991)Hydrophobicity-0.777Isoelectric Point4.04Molecular Weight6963.425Molecular FormulaC287H440N80O110S6Drugs Product Database (DPD)11916PubChem Substance46507011KEGG DrugD06880PharmGKBPA450195UniProtKBP01050Therapeutic Targets DatabaseDAP000541WikipediaLepirudinChEMBLCHEMBL1201666RxCUI237057RxListhttp://www.rxlist.com/cgi/generic/lepirudin.htmDrugs.comhttp://www.drugs.com/cdi/lepirudin.htmlSMP0000278Lepirudin Action Pathwaydrug_actionDB00001LepirudinDB01022PhylloquinoneDB01373CalciumP00734P00748P02452P03952P03951P00740P00451P12259P00742P02671P02675P02679P00488P05160P00747P00750P08709P13726Q9BQB6P38435BE0000048ProthrombinHumansinhibitorA170310505536Turpie AG: Anticoagulants in acute coronary syndromes. Am J Cardiol. 1999 Sep 2;84(5A):2M-6M.A170510912644Warkentin TE: Venous thromboembolism in heparin-induced thrombocytopenia. Curr Opin Pulm Med. 2000 Jul;6(4):343-51.A170711055889Eriksson BI: New therapeutic options in deep vein thrombosis prophylaxis. Semin Hematol. 2000 Jul;37(3 Suppl 5):7-9.A170911467439Fabrizio MC: Use of ecarin clotting time (ECT) with lepirudin therapy in heparin-induced thrombocytopenia and cardiopulmonary bypass. J Extra Corpor Technol. 2001 May;33(2):117-25.A171111807012Szaba FM, Smiley ST: Roles for thrombin and fibrin(ogen) in cytokine/chemokine production and macrophage adhesion in vivo. Blood. 2002 Feb 1;99(3):1053-9.A911752352Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5.yesProthrombinThrombospondin receptor activityThrombin, which cleaves bonds after Arg and Lys, converts fibrinogen to fibrin and activates factors V, VII, VIII, XIII, and, in complex with thrombomodulin, protein C. Functions in blood homeostasis, inflammation and wound healing.F211p11-q12Secreted1-245.770036.29511HumansHUGO Gene Nomenclature Committee (HGNC)HGNC:3535GenAtlasF2GenBank Gene DatabaseM17262GenBank Protein Database339641Guide to Pharmacology2362UniProtKBP00734UniProt AccessionTHRB_HUMAN3.4.21.5Coagulation factor II>lcl|BSEQ0016004|Prothrombin
MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLEREC
VEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHV
NITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQE
CSIPVCGQDQVTVAMTPRSEGSSVNLSPPLEQCVPDRGQQYQGRLAVTTHGLPCLAWASA
QAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETG
DGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLEDKTERELLESYI
DGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEN
DLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHP
VCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDST
RIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKY
GFYTHVFRLKKWIQKVIDQFGE>lcl|BSEQ0016005|Prothrombin (F2)
ATGGCGCACGTCCGAGGCTTGCAGCTGCCTGGCTGCCTGGCCCTGGCTGCCCTGTGTAGC
CTTGTGCACAGCCAGCATGTGTTCCTGGCTCCTCAGCAAGCACGGTCGCTGCTCCAGCGG
GTCCGGCGAGCCAACACCTTCTTGGAGGAGGTGCGCAAGGGCAACCTGGAGCGAGAGTGC
GTGGAGGAGACGTGCAGCTACGAGGAGGCCTTCGAGGCTCTGGAGTCCTCCACGGCTACG
GATGTGTTCTGGGCCAAGTACACAGCTTGTGAGACAGCGAGGACGCCTCGAGATAAGCTT
GCTGCATGTCTGGAAGGTAACTGTGCTGAGGGTCTGGGTACGAACTACCGAGGGCATGTG
AACATCACCCGGTCAGGCATTGAGTGCCAGCTATGGAGGAGTCGCTACCCACATAAGCCT
GAAATCAACTCCACTACCCATCCTGGGGCCGACCTACAGGAGAATTTCTGCCGCAACCCC
GACAGCAGCACCACGGGACCCTGGTGCTACACTACAGACCCCACCGTGAGGAGGCAGGAA
TGCAGCATCCCTGTCTGTGGCCAGGATCAAGTCACTGTAGCGATGACTCCACGCTCCGAA
GGCTCCAGTGTGAATCTGTCACCTCCATTGGAGCAGTGTGTCCCTGATCGGGGGCAGCAG
TACCAGGGGCGCCTGGCGGTGACCACACATGGGCTCCCCTGCCTGGCCTGGGCCAGCGCA
CAGGCCAAGGCCCTGAGCAAGCACCAGGACTTCAACTCAGCTGTGCAGCTGGTGGAGAAC
TTCTGCCGCAACCCAGACGGGGATGAGGAGGGCGTGTGGTGCTATGTGGCCGGGAAGCCT
GGCGACTTTGGGTACTGCGACCTCAACTATTGTGAGGAGGCCGTGGAGGAGGAGACAGGA
GATGGGCTGGATGAGGACTCAGACAGGGCCATCGAAGGGCGTACCGCCACCAGTGAGTAC
CAGACTTTCTTCAATCCGAGGACCTTTGGCTCGGGAGAGGCAGACTGTGGGCTGCGACCT
CTGTTCGAGAAGAAGTCGCTGGAGGACAAAACCGAAAGAGAGCTCCTGGAATCCTACATC
GACGGGCGCATTGTGGAGGGCTCGGATGCAGAGATCGGCATGTCACCTTGGCAGGTGATG
CTTTTCCGGAAGAGTCCCCAGGAGCTGCTGTGTGGGGCCAGCCTCATCAGTGACCGCTGG
GTCCTCACCGCCGCCCACTGCCTCCTGTACCCGCCCTGGGACAAGAACTTCACCGAGAAT
GACCTTCTGGTGCGCATTGGCAAGCACTCCCGCACCAGGTACGAGCGAAACATTGAAAAG
ATATCCATGTTGGAAAAGATCTACATCCACCCCAGGTACAACTGGCGGGAGAACCTGGAC
CGGGACATTGCCCTGATGAAGCTGAAGAAGCCTGTTGCCTTCAGTGACTACATTCACCCT
GTGTGTCTGCCCGACAGGGAGACGGCAGCCAGCTTGCTCCAGGCTGGATACAAGGGGCGG
GTGACAGGCTGGGGCAACCTGAAGGAGACGTGGACAGCCAACGTTGGTAAGGGGCAGCCC
AGTGTCCTGCAGGTGGTGAACCTGCCCATTGTGGAGCGGCCGGTCTGCAAGGACTCCACC
CGGATCCGCATCACTGACAACATGTTCTGTGCTGGTTACAAGCCTGATGAAGGGAAACGA
GGGGATGCCTGTGAAGGTGACAGTGGGGGACCCTTTGTCATGAAGAGCCCCTTTAACAAC
CGCTGGTATCAAATGGGCATCGTCTCATGGGGTGAAGGCTGTGACCGGGATGGGAAATAT
GGCTTCTACACACATGTGTTCCGCCTGAAGAAGTGGATACAGAAGGTCATTGATCAGTTT
GGAGAGTAGPF00594GlaPF00051KringlePF00089TrypsinPF09396Thrombin_lightcomponentblood microparticlecomponentcytosolcomponentendoplasmic reticulum lumencomponentextracellular exosomecomponentextracellular matrixcomponentextracellular regioncomponentextracellular spacecomponentGolgi lumencomponentplasma membranefunctioncalcium ion bindingfunctiongrowth factor activityfunctionreceptor bindingfunctionserine-type endopeptidase activityfunctionthrombospondin receptor activityprocessacute-phase responseprocessblood coagulationprocessblood coagulation, intrinsic pathwayprocesscell surface receptor signaling pathwayprocesscellular protein metabolic processprocesscellular response to mechanical stimulusprocesscytosolic calcium ion homeostasisprocessfibrinolysisprocessleukocyte migrationprocessmulticellular organismal developmentprocessnegative regulation of astrocyte differentiationprocessnegative regulation of fibrinolysisprocessnegative regulation of platelet activationprocessnegative regulation of proteolysisprocesspeptidyl-glutamic acid carboxylationprocessplatelet activationprocesspositive regulation of blood coagulationprocesspositive regulation of cell growthprocesspositive regulation of cell proliferationprocesspositive regulation of collagen biosynthetic processprocesspositive regulation of phosphatidylinositol 3-kinase signalingprocesspositive regulation of phospholipase C-activating G-protein coupled receptor signaling pathwayprocesspositive regulation of protein phosphorylationprocesspositive regulation of reactive oxygen species metabolic processprocesspositive regulation of release of sequestered calcium ion into cytosolprocesspost-translational protein modificationprocessproteolysisprocessregulation of blood coagulationprocessregulation of cell shapeprocessregulation of gene expressionprocessresponse to inactivityprocessresponse to wounding
1，java读取.properties配置文件
InputStream in;
try {
in = test.class.getClassLoader().getResourceAsStream("config/ipnetOracle.properties");//配置文件的路径
Properties p = new Properties()
create or replace procedure proc_test01
as
type emp_row is record(
empno emp.empno%type,
ename emp.ename%type,
job emp.job%type,
mgr emp.mgr%type,
hiberdate emp.hiredate%type,
sal emp.sal%t
今天在执行一个脚本时，本来是想在脚本中启动hdfs和hive等程序，可以在执行到service hive-server start等启动服务的命令时会报错，最终解决方法记录一下：
脚本报错如下：
./olap_quick_intall.sh: line 57: service: command not found
./olap_quick_intall.sh: line 59
最近重新安装的电脑，配置了新环境，老是出现：
adb server is out of date. killing...
ADB server didn't ACK
* failed to start daemon *
百度了一下，说是端口被占用，我开个eclipse，然后打开cmd，就提示这个，很烦人。
一个比较彻底的解决办法就是修改
import java.util.HashMap;
public class Title {
public static void main(String[] args){
f();
}
// 二位数组的应用
//12、二维数组中，哪一行或哪一列的连续存放的0的个数最多，是几个0。注意，是“连续”。
public static void f(){
